Definition Acidovorax citrulli AAC00-1 chromosome, complete genome.
Accession NC_008752
Length 5,352,772

Click here to switch to the map view.

The map label for this gene is yvrE [H]

Identifier: 120610933

GI number: 120610933

Start: 2485814

End: 2486761

Strand: Direct

Name: yvrE [H]

Synonym: Aave_2259

Alternate gene names: 120610933

Gene position: 2485814-2486761 (Clockwise)

Preceding gene: 120610931

Following gene: 120610934

Centisome position: 46.44

GC content: 74.37

Gene sequence:

>948_bases
ATGCCTTCCGGCACCCCGCCGGCCGTGTCCTGGCCCGCCCCCGCGACCGGCGCGGCGCGCTGCGTGCGGCCCATGGCCTC
CCAGCTGGGCGAGGGCCTGCTGTGGTCGGAGCGCGAACAGGCGCTGTACTGGGTGGACATCCTCGCCCGCGAACTGCACC
GCTGGGACCCCGCAGGCGGCGCGCACCGCTGCTGGACCTTCGAGGAGGAAATCTCCGCGCTGGCCGAGCGCGCCGCGGCG
CCCGGCCTCCTCGTCACCCTGCGCCGCGGCTTCGCGCTGTTCGACCCGGCCGCCGACACCGCGCCGCGCTACCTGCACCA
GCCCGAACCGGAGCGCGCCGGCAACCGCTTCAACGACGGCAAGTGCGATGCGCAGGGGCGCTTCTGGGCCGGATCGATGG
ACTTCGGCTGCGAGGCACCCACCGGCGCGCTCTACCGCTTCGATCCCGATGGCCGCTGCACGCGGCACGACGACGGCTTC
GCGGTGACCAATGGCCCGGCCTGGTCGCACGCCGGGGCTGCGGGCGGGACGCGGGCGCCGGCCATGTTCTTCAACGCCAC
CGCCGAGGCCTGCACCTACCGCTACGACTTCGACCCCGGCACGGGAGCGCTGTCGAACCGGACGCTGTGGAAGCGCTGGT
CCGCAGAAGACGGGCTGCCCGACGGCATGACCACCGATGCGCAGGGGCGGCTGTGGATCGCTCACTGGGGCGGCGCATGC
GTGACCTGCCACGATCCCGCGAGCGCCGCCGAACTGTGCCGCGTCCCCCTGCCGGTGAGCCAGGTCACCACCTGCGCCTT
CGGCGGCCCCGACCTGCGCACGCTCTTCATCATCTCCGCCCGCGTGGGCCTGTCGGATGCCCGGCTGGTGGCCGAGCCCC
TGGCCGGATCGCTCTTCGCCGTCTCCGTGGACGGCCCCGGCCTGCCGGCCCATCGCTTCGGCGGCTGA

Upstream 100 bases:

>100_bases
TACGTGCATCAATTTGCGTTGATAAGATCCGCCGCGTCAAGAGGCCCGCGACAGACGGGCGCTGAAACAACGTCTGGAGA
CGCGCATGAATCCTCCCGAG

Downstream 100 bases:

>100_bases
CCTCCTGGAGACGCCCCATGAACGAGACCTTCCATCCCGTCACCTGGCTGCACCATGCCGGCCAGCACCTGGGCCTCGTG
CCGTCGCTGGGCGGCAGCGT

Product: gluconolactonase

Products: NA

Alternate protein names: NA

Number of amino acids: Translated: 315; Mature: 314

Protein sequence:

>315_residues
MPSGTPPAVSWPAPATGAARCVRPMASQLGEGLLWSEREQALYWVDILARELHRWDPAGGAHRCWTFEEEISALAERAAA
PGLLVTLRRGFALFDPAADTAPRYLHQPEPERAGNRFNDGKCDAQGRFWAGSMDFGCEAPTGALYRFDPDGRCTRHDDGF
AVTNGPAWSHAGAAGGTRAPAMFFNATAEACTYRYDFDPGTGALSNRTLWKRWSAEDGLPDGMTTDAQGRLWIAHWGGAC
VTCHDPASAAELCRVPLPVSQVTTCAFGGPDLRTLFIISARVGLSDARLVAEPLAGSLFAVSVDGPGLPAHRFGG

Sequences:

>Translated_315_residues
MPSGTPPAVSWPAPATGAARCVRPMASQLGEGLLWSEREQALYWVDILARELHRWDPAGGAHRCWTFEEEISALAERAAA
PGLLVTLRRGFALFDPAADTAPRYLHQPEPERAGNRFNDGKCDAQGRFWAGSMDFGCEAPTGALYRFDPDGRCTRHDDGF
AVTNGPAWSHAGAAGGTRAPAMFFNATAEACTYRYDFDPGTGALSNRTLWKRWSAEDGLPDGMTTDAQGRLWIAHWGGAC
VTCHDPASAAELCRVPLPVSQVTTCAFGGPDLRTLFIISARVGLSDARLVAEPLAGSLFAVSVDGPGLPAHRFGG
>Mature_314_residues
PSGTPPAVSWPAPATGAARCVRPMASQLGEGLLWSEREQALYWVDILARELHRWDPAGGAHRCWTFEEEISALAERAAAP
GLLVTLRRGFALFDPAADTAPRYLHQPEPERAGNRFNDGKCDAQGRFWAGSMDFGCEAPTGALYRFDPDGRCTRHDDGFA
VTNGPAWSHAGAAGGTRAPAMFFNATAEACTYRYDFDPGTGALSNRTLWKRWSAEDGLPDGMTTDAQGRLWIAHWGGACV
TCHDPASAAELCRVPLPVSQVTTCAFGGPDLRTLFIISARVGLSDARLVAEPLAGSLFAVSVDGPGLPAHRFGG

Specific function: Unknown

COG id: COG3386

COG function: function code G; Gluconolactonase

Gene ontology:

Cell location: Cytoplasm (Potential) [H]

Metaboloic importance: NA

Operon status: Not Known

Operon components: None

Similarity: Belongs to the SMP-30/CGR1 family [H]

Homologues:

Organism=Homo sapiens, GI23111021, Length=302, Percent_Identity=30.4635761589404, Blast_Score=150, Evalue=2e-36,
Organism=Homo sapiens, GI4759036, Length=302, Percent_Identity=30.4635761589404, Blast_Score=150, Evalue=2e-36,
Organism=Drosophila melanogaster, GI45551448, Length=270, Percent_Identity=30.7407407407407, Blast_Score=120, Evalue=1e-27,
Organism=Drosophila melanogaster, GI24641471, Length=270, Percent_Identity=30.7407407407407, Blast_Score=120, Evalue=1e-27,
Organism=Drosophila melanogaster, GI18860103, Length=270, Percent_Identity=30.7407407407407, Blast_Score=120, Evalue=1e-27,
Organism=Drosophila melanogaster, GI24641469, Length=270, Percent_Identity=30.7407407407407, Blast_Score=120, Evalue=1e-27,
Organism=Drosophila melanogaster, GI24646912, Length=267, Percent_Identity=29.2134831460674, Blast_Score=114, Evalue=8e-26,
Organism=Drosophila melanogaster, GI24646910, Length=267, Percent_Identity=29.2134831460674, Blast_Score=114, Evalue=8e-26,

Paralogues:

None

Copy number: NA

Swissprot (AC and ID): NA

Other databases:

- InterPro:   IPR011042
- InterPro:   IPR013658
- InterPro:   IPR005511 [H]

Pfam domain/function: PF08450 SGL [H]

EC number: NA

Molecular weight: Translated: 33701; Mature: 33570

Theoretical pI: Translated: 5.85; Mature: 5.85

Prosite motif: NA

Important sites: NA

Signals:

None

Transmembrane regions:

None

Cys/Met content:

3.2 %Cys     (Translated Protein)
1.6 %Met     (Translated Protein)
4.8 %Cys+Met (Translated Protein)
3.2 %Cys     (Mature Protein)
1.3 %Met     (Mature Protein)
4.5 %Cys+Met (Mature Protein)

Secondary structure:

>Translated Secondary Structure
MPSGTPPAVSWPAPATGAARCVRPMASQLGEGLLWSEREQALYWVDILARELHRWDPAGG
CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
AHRCWTFEEEISALAERAAAPGLLVTLRRGFALFDPAADTAPRYLHQPEPERAGNRFNDG
CCEEEEHHHHHHHHHHHHCCCCEEEEECCCCEEECCCCCCCCHHHCCCCHHHHCCCCCCC
KCDAQGRFWAGSMDFGCEAPTGALYRFDPDGRCTRHDDGFAVTNGPAWSHAGAAGGTRAP
CCCCCCCEEECCCCCCCCCCCCCEEEECCCCCCEECCCCEEEECCCCCCCCCCCCCCCCC
AMFFNATAEACTYRYDFDPGTGALSNRTLWKRWSAEDGLPDGMTTDAQGRLWIAHWGGAC
EEEEECCHHHEEEEEECCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCEE
VTCHDPASAAELCRVPLPVSQVTTCAFGGPDLRTLFIISARVGLSDARLVAEPLAGSLFA
EEECCCCCHHHHHCCCCCHHHHHEEECCCCCCEEEEEEEECCCCCHHHHHHHCCCCCEEE
VSVDGPGLPAHRFGG
EEECCCCCCCCCCCC
>Mature Secondary Structure 
PSGTPPAVSWPAPATGAARCVRPMASQLGEGLLWSEREQALYWVDILARELHRWDPAGG
CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
AHRCWTFEEEISALAERAAAPGLLVTLRRGFALFDPAADTAPRYLHQPEPERAGNRFNDG
CCEEEEHHHHHHHHHHHHCCCCEEEEECCCCEEECCCCCCCCHHHCCCCHHHHCCCCCCC
KCDAQGRFWAGSMDFGCEAPTGALYRFDPDGRCTRHDDGFAVTNGPAWSHAGAAGGTRAP
CCCCCCCEEECCCCCCCCCCCCCEEEECCCCCCEECCCCEEEECCCCCCCCCCCCCCCCC
AMFFNATAEACTYRYDFDPGTGALSNRTLWKRWSAEDGLPDGMTTDAQGRLWIAHWGGAC
EEEEECCHHHEEEEEECCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCEE
VTCHDPASAAELCRVPLPVSQVTTCAFGGPDLRTLFIISARVGLSDARLVAEPLAGSLFA
EEECCCCCHHHHHCCCCCHHHHHEEECCCCCCEEEEEEEECCCCCHHHHHHHCCCCCEEE
VSVDGPGLPAHRFGG
EEECCCCCCCCCCCC

PDB accession: NA

Resolution: NA

Structure class: Alpha Beta

Cofactors: NA

Metal ions: NA

Kcat value (1/min): NA

Specific activity: NA

Km value (mM): NA

Substrates: NA

Specific reaction: NA

General reaction: NA

Inhibitor: NA

Structure determination priority: 10.0

TargetDB status: NA

Availability: NA

References: 9639930; 9384377 [H]