LOCUS NC_006970 2773 bp DNA circular BCT 22-FEB-2010 DEFINITION Rhodococcus opacus B4 plasmid pKNR02, complete sequence. ACCESSION NC_006970 VERSION NC_006970.2 GI:226316799 DBLINK Project: 13791 KEYWORDS . SOURCE Rhodococcus opacus B4 ORGANISM Rhodococcus opacus B4 Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; Corynebacterineae; Nocardiaceae; Rhodococcus. REFERENCE 1 AUTHORS Na,K.S., Nagayasu,K., Kuroda,A., Takiguchi,N., Ikeda,T., Ohtake,H. and Kato,J. TITLE Development of a genetic transformation system for benzene-tolerant Rhodococcus opacus strains JOURNAL J. Biosci. Bioeng. 99 (4), 408-414 (2005) PUBMED 16233810 REFERENCE 2 AUTHORS Takarada,H., Sekine,M., Hosoyama,A., Yamada,R., Fujisawa,T., Omata,S., Shimizu,A., Tsukatani,N., Tanikawa,S., Fujita,N. and Harayama,S. TITLE Comparison of the complete genome sequences of Rhodococcus erythropolis PR4 and Rhodococcus opacus B4 JOURNAL Unpublished REFERENCE 3 (bases 1 to 2773) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (02-APR-2009) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 4 (bases 1 to 2773) AUTHORS Sekine,M., Hosoyama,A., Kosugi,H., Yamada,R., Matsuo,Y., Tsukatani,N., Fujisawa,T., Takarada,H., Omata,S., Kishi,E., Shimizu,A., Koga,C., Saito,S., Nakazawa,H., Sekigawa,T., Nishiko,R., Takeyama,M., Tanikawa,S., Tago,S., Fujita,N., Kato,J., Na,K.S., Ohtake,H., Nagayasu,K. and Harayama,S. TITLE Direct Submission JOURNAL Submitted (30-MAR-2009) Contact:Director-General Department of Biotechnology National Institute of Technology and Evaluation, NITE Genome Analysis Center (NGAC), Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066, Japan URL :http://www.bio.nite.go.jp/ COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AP011120. On Apr 2, 2009 this sequence version replaced gi:62718928. Kato,J., Na,K., Ohtake,H. and Nagayasu,K. are at Department of Molecular Biotechnology, Hiroshima University. Rhodococcus opacus B-4 strain was isolated as a benzene-tolerant bacterium (Kyung-su Na et al 2005). The complete genome analysis of R. opacus B-4 was carried out by NITE. The genome analysis indicated that this strain has one linear chromosome, two linear plasmids pROB01, pROB02, and three circular plasmids pKNR, pKNR01, pKNR02. The nucleotide sequence of the linear plasmid pKNR02 was previously determined independently by Kato et al and was registered with the accession number AB193160, which is now merged with this record with the permission of Dr. Kato. The differences between the entry AB193160 and this record are as follows. 'C' at position 1965 replaced 'T'. 'G' was deleted between positions 2576 and 2577. This work was supported by New Energy and Industrial Technology Development Organization (NEDO). Please visit our web site. URL:http://www.bio.nite.go.jp/ DOGAN ; Database of Genomes Analyzed at NITE The database contains genome sequence data, physical maps and the genomic and proteomic data of the microorganisms analyzed. URL:http://www.bio.nite.go.jp/dogan/Top The microbial genomic DNA clones used for the sequencing project are available through the NBRC. URL:http://www.nbrc.nite.go.jp/e/index.html. COMPLETENESS: full length. FEATURES Location/Qualifiers source 1..2773 /organism="Rhodococcus opacus B4" /mol_type="genomic DNA" /strain="B4" /db_xref="taxon:632772" /plasmid="pKNR02" gene 630..1244 /locus_tag="ROP_pKNR02-00010" /db_xref="GeneID:3936862" CDS 630..1244 /locus_tag="ROP_pKNR02-00010" /codon_start=1 /transl_table=11 /product="hypothetical protein" /protein_id="YP_227550.1" /db_xref="GI:62718929" /db_xref="GeneID:3936862" /translation="MREGAREQSAPPKRQNVDLEQGSRVVSCRRGVRRCVLCGRSVGR VATPRSGITRAPGPGCSVACRGSRIVAPPYRSARCRCPGLPSPPPRPIGYALWSHYTR GPAGGGLEGSSCITPPERHTPNAFALPEFSSTLVTAVSIVLKKPPDANPIGGFFYART TFPVPRQNTGNATRSISHDCEESRLVYLPNTRGMKKAGTYFGPA" gene 1374..1964 /locus_tag="ROP_pKNR02-00020" /db_xref="GeneID:3936863" CDS 1374..1964 /locus_tag="ROP_pKNR02-00020" /codon_start=1 /transl_table=11 /product="hypothetical protein" /protein_id="YP_227551.1" /db_xref="GI:62718930" /db_xref="GeneID:3936863" /translation="MPASPPSNNPSSGTPASMPGRPRWSASEAARRCGVGRSTIQRAL VAGRIPDAVETEKGWSIPLDGLLAAGFTPDRPSPPDPTLTSPPNPARGHDRAPTNNDG EHARRIAELELALERERARAELEHARRVAAEQLAAERAERVADLRHTLRMIEAPLAEQ LHGAPEESPVEPPVAPATSTEQAPTLFGLLGRLLNR" ORIGIN 1 agatctcgat ggcgcggaca attcgaggct gaacggagtc agacatggct tggttccttc 61 ccgagaccga gcgggcagca tgaagcgcac gactacgcgc actgcccttc tgtctcatgg 121 ggacgaggaa gccgccggag gtgcatcacc cgcggcggct tcagtgaatg gatatgaggg 181 gcagagcgtc gagctcgcgg catgcaaaag gccggcgccg aggacggggc cggccgagta 241 ggttgccgct gatcgtttag ttgtggttgt agatcggtcg cggaagagat cgcatcgacg 301 gcggcgcgtg cgcgtagtag ccgaacatca ggcccccttc acagaagtcg aagtgactcg 361 gtctaccgca ccgcgtgccg tacccgactt accttccgca gtctgagact cagtcccgtt 421 ccccagtgct tgccttgctg tggtccaggt ccaaggcagc accgacaaga ccgaacacac 481 ctcttgcact aacagtgcgt cctgggagtt ctcaccggtt ggtgaggtct gaaagaagcg 541 tcctgtttgg tcactgggct caagcaaagg gcctcgcttt gctcggactg ttctctcaag 601 cgctctgctc aacgtcttgt ccgaccctca tgcgggaggg agcgagggag cagagcgcgc 661 cccccaaacg gcaaaacgtg gatctcgaac agggttcgag ggtggtgtct tgccgtcggg 721 gggtgcgtag gtgtgtgctc tgcggtcggt cggtcggtcg cgtcgctacg ccgcgctcgg 781 ggattactcg agcgccaggg ccggggtgtt cggtcgcgtg ccgggggagc cgcatagtcg 841 cgcccccgta ccgctctgcg cgttgtaggt gtccgggcct gccttcacca ccgccgcgac 901 cgatcgggta tgccctttgg tctcactaca cccgggggcc agccggtggg ggtctggaag 961 ggagttcgtg tatcacgcca cctgagcgac acacccccaa cgctttcgcg ctgccagagt 1021 tctccagtac cctggtcact gcagtttcga tcgttttgaa aaagcccccg gacgccaatc 1081 caataggggg ctttttctat gcccggacca cctttccagt tcccagacaa aacaccggta 1141 acgccacgcg ctcgatttcg cacgactgcg aagagtcccg gctggtgtat ctcccaaaca 1201 cccggggcat gaaaaaggcc ggcacctatt tcggtccggc ctgatctaac tttgcgcggg 1261 cacagttcat ccgcagtcat aactatgaca ggtcaacgta gtgcgacctt ttagacccgc 1321 cttttcggcg tgcctatctg ttgctgccgc cctggcccgg gcagggtaag tgcatgcccg 1381 cgagccctcc ttcgaacaac ccgtcttcgg gcacgcccgc gagcatgccc gggcggcctc 1441 gctggtccgc ttccgaggca gcccgccgct gtggagtcgg gcgctcgacc atccaacgag 1501 cgttggtcgc tggccggatc cccgatgcag ttgagacgga gaagggctgg tcgatcccat 1561 tggacgggct tctggctgcc ggcttcacac ctgaccgtcc cagtcctcca gatccaacac 1621 tgaccagccc gccgaacccc gcacgcgggc atgaccgagc acctacaaac aacgacggcg 1681 agcatgcccg ccggatcgcc gagctggagc tggcgctgga acgcgagcgt gcccgagccg 1741 agctggagca cgctcgccgg gtcgcggcgg aacaactcgc tgccgaacgc gccgaacgtg 1801 tcgccgacct ccgacacaca ctccgcatga tcgaagcacc tctcgccgaa caactgcacg 1861 gcgctccgga ggagtcgccg gtagagccac cagtagcgcc ggcgacatct accgagcaag 1921 caccaacgct gttcggcctg ctgggtcgac tgctcaaccg gtagccaccg cgcccggggc 1981 cggcgcgggc accaaagaac gacctcgcga catgaaaaag gccggcacct gttcgaaggt 2041 ccggcctgat tttgggcgca cgatctcgcc aacggcctca gcctatcagc ggcggtgtta 2101 caaaccctgt caagcacatc cacaccggcg tgtcgcgaga gcatttttcg ttggcaaggg 2161 gctgcgcagc ggcctcgcgg cagctgcacc cctcacgact accttgcccg gcaagatcgc 2221 cgaacgaggg agtagcagct cgccatgcca gacccgaaga aaacacccac gcgagcagaa 2281 accctgcgcg cctggatcac gacactgaca ccgatcgcgg tcgcgatcat caccgcagcc 2341 accgctgtga tcgtgcggtg aatcaggccc agcgcagcgc cccgacaggg acaccgcgaa 2401 acgcgggcac ggacttaggt cacctaagtc tccatcttgc tccgccggag caagacctcc 2461 tggtgcgcga ccgctcgcgc acccgcactc ctcacttacg tgaggtaagt gtctatcttg 2521 ctctccgcac aagcagccga gccgcgacca atccgatgcg accagaccgc ttggccgccg 2581 gtaacagctg ctgttaccgg cggccctccc aacagtctga ggttcagcaa gaggtgtgtc 2641 tgaaacttcg gtgtcgaagt aggcagccga cgctgcactg gtcactggaa aagctcccac 2701 acccgggaga ccaacagcgc ggcttgcagt gcgcggtaaa cgatcatcaa gatcggtgcc 2761 gctcgtcggt agg //